ARG40378
anti-MAOA antibody
anti-MAOA antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes MAOA |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | FACS, ICC/IF, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | MAOA |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 457-493 of Human MAOA. (REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER) |
| Conjugation | Un-conjugated |
| Alternate Names | MAO-A; EC 1.4.3.4; Amine oxidase [flavin-containing] A; Monoamine oxidase type A |
Application Instructions
| Application Suggestion |
|
||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
||||||||||
| Observed Size | 60 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # P21397 Human Amine oxidase [flavin-containing] A Swiss-port # Q64133 Mouse Amine oxidase [flavin-containing] A |
|---|---|
| Gene Symbol | MAOA |
| Gene Full Name | monoamine oxidase A |
| Background | This gene is one of two neighboring gene family members that encode mitochondrial enzymes which catalyze the oxidative deamination of amines, such as dopamine, norepinephrine, and serotonin. Mutation of this gene results in Brunner syndrome. This gene has also been associated with a variety of other psychiatric disorders, including antisocial behavior. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012] |
| Function | Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine. [UniProt] |
| Cellular Localization | Mitochondrion outer membrane; Single-pass type IV membrane protein; Cytoplasmic side. [UniProt] |
| Calculated MW | 60 kDa |
Images (7) Click the Picture to Zoom In
-
ARG40378 anti-MAOA antibody ICC/IF image
Immunofluorescence: U2OS cells were blocked with 10% goat serum and then stained with ARG40378 anti-MAOA antibody (green) at 5 µg/ml dilution, overnight at 4°C. DAPI (blue) for nuclear staining.
-
ARG40378 anti-MAOA antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse cardiac muscle stained with ARG40378 anti-MAOA antibody.
-
ARG40378 anti-MAOA antibody WB image
Western blot: 50 µg Rat kidney, 50 µg of Mouse kidney, 40 µg of COLO320, 40 µg of HepG2 and 40 µg of HEPA whole cell lysates stained with ARG40378 anti-MAOA antibody at 0.5 µg/ml dilution.
-
ARG40378 anti-MAOA antibody FACS image
Flow Cytometry: U87 cells were blocked with 10% normal goat serum and then stained with ARG40378 anti-MAOA antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
-
ARG40378 anti-MAOA antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat cardiac muscle stained with ARG40378 anti-MAOA antibody.
-
ARG40378 anti-MAOA antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human intestinal cancer tissue stained with ARG40378 anti-MAOA antibody.
-
ARG40378 anti-MAOA antibody FACS image
Flow Cytometry: U2OS cells were blocked with 10% normal goat serum and then stained with ARG40378 anti-MAOA antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
