ARG40281
anti-Lysozyme antibody
anti-Lysozyme antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Lysozyme |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Lysozyme |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 106-141 of Human Lysozyme. (NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ) |
| Conjugation | Un-conjugated |
| Alternate Names | EC 3.2.1.17; Lysozyme C; LZM; 1,4-beta-N-acetylmuramidase C |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
||||||
| Observed Size | ~ 19 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | LYZ |
| Gene Full Name | lysozyme |
| Background | This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis. [provided by RefSeq, Oct 2014] |
| Function | Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. [UniProt] |
| Cellular Localization | Secreted. [UniProt] |
| Calculated MW | 17 kDa |
Images (6) Click the Picture to Zoom In
-
ARG40281 anti-Lysozyme antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human intestinal cancer stained with ARG40281 anti-Lysozyme antibody.
-
ARG40281 anti-Lysozyme antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human ileum tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40281 anti-Lysozyme antibody (red) at 5 µg/ml dilution, overnight at 4°C. The section was counterstained with DAPI (blue).
-
ARG40281 anti-Lysozyme antibody WB image
Western blot: 50 µg of Rat intestine, 50 µg of Rat kidney, 50 µg of Rat liver, 40 µg of HeLa, 40 µg of SW620, 40 µg of 293T and 40 µg of HepG2 whole cell lysates stained with ARG40281 anti-Lysozyme antibody at 0.5 µg/ml dilution.
-
ARG40281 anti-Lysozyme antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human colon organoid tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40281 anti-Lysozyme antibody (red) at 5 µg/ml dilution, overnight at 4°C. The section was counterstained with DAPI (blue).
-
ARG40281 anti-Lysozyme antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse ileum tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40281 anti-Lysozyme antibody (red) at 5 µg/ml dilution, overnight at 4°C. The section was counterstained with DAPI (blue).
-
ARG40281 anti-Lysozyme antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse ileum organoid tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40281 anti-Lysozyme antibody (red) at 5 µg/ml dilution, overnight at 4°C. The section was counterstained with DAPI (blue).
