ARG59893

anti-LRIG3 antibody

anti-LRIG3 antibody for Western blot and Human,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes LRIG3
Tested Reactivity Hu, Rat
Predict Reactivity Bov, Hrs, Mk, Rb
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name LRIG3
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 428-465 of Human LRIG3. (NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ)
Conjugation Un-conjugated
Alternate Names LIG-3; Leucine-rich repeats and immunoglobulin-like domains protein 3; LIG3

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size ~ 120 kDa

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 121227 Human LRIG3

Swiss-port # Q6UXM1 Human Leucine-rich repeats and immunoglobulin-like domains protein 3

Gene Symbol LRIG3
Gene Full Name leucine-rich repeats and immunoglobulin-like domains 3
Function May play a role in craniofacial and inner ear morphogenesis during embryonic development. May act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1 (By similarity). [UniProt]
Cellular Localization Cell membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Note=Detected in cytoplasmic vesicles when coexpressed with ERBB4. [UniProt]
Calculated MW 123 kDa

Images (1) Click the Picture to Zoom In

  • ARG59893 anti-LRIG3 antibody WB image

    Western blot: Rat testis and HepG2 whole cell lysates stained with ARG59893 anti-LRIG3 antibody at 0.5 µg/ml dilution.