ARG59246
anti-IRF9 antibody
anti-IRF9 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes IRF9 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Zfsh |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | IRF9 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human IRF9. (within the following region: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK) |
| Conjugation | Un-conjugated |
| Alternate Names | ISGF-3 gamma; Transcriptional regulator ISGF3 subunit gamma; ISGF3G; ISGF3; Interferon-stimulated gene factor 3 gamma; IRF-9; ISGF3 p48 subunit; p48; IFN-alpha-responsive transcription factor subunit; Interferon regulatory factor 9 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% | ||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Positive Control | HepG2 | ||||||
| Observed Size | ~ 40 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | IRF9 |
| Gene Full Name | interferon regulatory factor 9 |
| Function | Transcription factor that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. IRF9/ISGF3G associates with the phosphorylated STAT1:STAT2 dimer to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state. [UniProt] |
| Cellular Localization | Cytoplasm. Nucleus. Note=Translocated into the nucleus upon activation by IFN-alpha/beta. [UniProt] |
| Calculated MW | 44 kDa |
Images (2) Click the Picture to Zoom In
-
ARG59246 anti-IRF9 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human liver stained with ARG59246 anti-IRF9 antibody.
-
ARG59246 anti-IRF9 antibody WB image
Western blot: HepG2 cell lysate stained with ARG59246 anti-IRF9 antibody at 0.2 - 1 µg/ml dilution.
