ARG40963

anti-ILF2 / NF45 antibody

anti-ILF2 / NF45 antibody for IHC-Formalin-fixed paraffin-embedded sections and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes ILF2 / NF45
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Zfsh
Tested Application IHC-P
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name ILF2 / NF45
Antigen Species Human
Immunogen Synthetic peptide around the C-terminal region of Human ILF2. (within the following region: HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEEEE)
Conjugation Un-conjugated
Alternate Names Interleukin enhancer-binding factor 2; NF45; Nuclear factor of activated T-cells 45 kDa; PRO3063

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Application Suggestion
Tested Application Dilution
IHC-P1 - 2 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Purification with Protein A.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 3608 Human ILF2

Swiss-port # Q12905 Human Interleukin enhancer-binding factor 2

Gene Symbol ILF2
Gene Full Name interleukin enhancer binding factor 2
Background The protein encoded by this gene is a transcription factor required for T-cell expression of the interleukin 2 gene. It also binds RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. The encoded 45 kDa protein (NF45, ILF2) forms a complex with the 90 kDa interleukin enhancer-binding factor 3 (NF90, ILF3), and this complex has been shown to affect the redistribution of nuclear mRNA to the cytoplasm, to repair DNA breaks by nonhomologous end joining, and to negatively regulate the microRNA processing pathway. Knockdown of NF45 or NF90 protein retards cell growth, possibly by inhibition of mRNA stabilization. Alternative splicing results in multiple transcript variants. Related pseudogenes have been found on chromosomes 3 and 14. [provided by RefSeq, Dec 2014]
Function Appears to function predominantly as a heterodimeric complex with ILF3. This complex may regulate transcription of the IL2 gene during T-cell activation. It can also promote the formation of stable DNA-dependent protein kinase holoenzyme complexes on DNA. Essential for the efficient reshuttling of ILF3 (isoform 1 and isoform 2) into the nucleus. [UniProt]
Cellular Localization Nucleus, nucleolus. Cytoplasm. Nucleus. Note=Localized in cytoplasmic mRNP granules containing untranslated mRNAs. [UniProt]
Calculated MW 43 kDa

Images (2) Click the Picture to Zoom In

  • ARG40963 anti-ILF2 / NF45 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human kidney tissue stained with ARG40963 anti-ILF2 / NF45 antibody.

  • ARG40963 anti-ILF2 / NF45 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human cardiac tissue (epithelial cells of renal tubule) stained with ARG40963 anti-ILF2 / NF45 antibody at 4 - 8 µg/ml dilution.