ARG41102
anti-IL28RA antibody
anti-IL28RA antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes IL28RA |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | IL28RA |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human IL28RA. (within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF) |
| Conjugation | Un-conjugated |
| Alternate Names | IFNLR; IFN-lambda-R1; IL-28RA; IL28RA; Interferon lambda receptor 1; LICR2; CRF2-12; IFN-lambda receptor 1; Cytokine receptor class-II member 12; Interleukin-28 receptor subunit alpha; Likely interleukin or cytokine receptor 2; IL-28R1; CRF2/12; Cytokine receptor family 2 member 12; IL-28R-alpha; IL-28 receptor subunit alpha |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 92%; Dog: 100%; Guinea pig: 100%; Horse: 86%; Mouse: 77%; Rabbit: 86%; Rat: 92% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | IFNLR1 |
| Gene Full Name | interferon, lambda receptor 1 |
| Background | The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
| Function | The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity. The ligand/receptor complex stimulate the activation of the JAK/STAT signaling pathway leading to the expression of IFN-stimulated genes (ISG), which contribute to the antiviral state. Determines the cell type specificity of the lambda interferon action. Shows a more restricted pattern of expression in the epithelial tissues thereby limiting responses to lambda interferons primarily to epithelial cells of the respiratory, gastrointestinal, and reproductive tracts. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium. [UniProt] |
| Cellular Localization | Membrane; Single-pass type I membrane protein. [UniProt] |
| Calculated MW | 58 kDa |
Images (1) Click the Picture to Zoom In
-
ARG41102 anti-IL28RA antibody WB image
Western blot: Human fetal lung lysate stained with ARG41102 anti-IL28RA antibody at 1 µg/ml dilution.
