ARG10675
anti-IGFBP3 antibody
anti-IGFBP3 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes IGFBP3 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | IGFBP3 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to the sequence at a.a 214-252 (RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR) around the C-terminus of human IGFBP3 protein. |
| Conjugation | Un-conjugated |
| Alternate Names | IBP3; BP-53; IGF-binding protein 3; IGFBP-3 |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Boil tissue sections in 10 mM Citrate buffer (pH 6.0) for 20 min * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
||||||
| Positive Control | Rat heart, Rat brain, Rat liver, PC-12, U-87 MG, Mouse kidney, Mouse heart and Mouse brain | ||||||
| Observed Size | ~ 40 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 1X PBS, 0.025% Sodium azide and 2.7% BSA |
| Preservative | 0.027% Sodium azide |
| Stabilizer | 2.7% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | IGFBP3 |
| Gene Full Name | Insulin Like Growth Factor Binding Protein 3 |
| Background | This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
| Calculated MW | 32 kDa |
| PTM | Phosphorylated by FAM20C in the extracellular medium. |
Images (3) Click the Picture to Zoom In
-
ARG10675 anti-IGFBP3 antibody IHC-P image
Immunohistochemistry: Human intestinal cancer (paraffin-embedded sections) stained with ARG10675 anti-IGFBP3 antibody
Human intestinal cancer
-
ARG10675 anti-IGFBP3 antibody WB image
Western blot: 1) rat kidney, 2) rat liver, 3) human SGC, 4) human 22RV1 lysates stained with ARG10675 anti-IGFBP3 antibody
1) rat kidney, 2) rat liver, 3) human SGC, 4) human 22RV1
-
ARG10675 anti-IGFBP3 antibody WB image
Western blot: Rat heart, Rat brain, Rat liver, PC-12, U-87 MG, Mouse kidney, Mouse heart and Mouse brain lysates stained with ARG10675 anti-IGFBP3 antibody.
