ARG10676
anti-IGFBP1 antibody
anti-IGFBP1 antibody for Western blot and Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes IGFBP1 |
|---|---|
| Tested Reactivity | Ms, Rat |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | IGFBP1 |
| Antigen Species | Mouse |
| Immunogen | Synthetic peptide corresponding to the sequence at a.a 177-207 (REIADLKKWKEPCQRELYKVLERLAAAQQKA) around the C-terminus of mouse IGFBP1 protein. |
| Conjugation | Un-conjugated |
| Alternate Names | AFBP; IBP1; PP12; IGF-BP25; hIGFBP-1; IGF-binding protein 1; IGFBP-1; Placental protein 12 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 1X PBS, 0.025% Sodium azide and 2.5% BSA |
| Preservative | 0.025% Sodium azide |
| Stabilizer | 2.5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # P21743 Rat Insulin-like growth factor-binding protein 1 Swiss-port # P47876 Mouse Insulin-like growth factor-binding protein 1 |
|---|---|
| Gene Symbol | Igfbp1 |
| Gene Full Name | Insulin Like Growth Factor Binding Protein 1 |
| Background | This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. [provided by RefSeq, Jul 2008] |
| Function | GF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration. [UniProt] |
| Calculated MW | 28 kDa |
| PTM | Phosphorylated; probably by casein kinase II. Phosphorylation alters the affinity of the protein for IGFs. In amniotic fluid, the unmodified protein is the most abundant form, while mono-, bi-, tri- and tetraphosphorylated forms are present in decreasing amounts. The phosphorylation state may influence the propensity to proteolysis. |
Images (1) Click the Picture to Zoom In
-
ARG10676 anti-IGFBP1 antibody WB image
Western blot: 1) rat kidney, 2) mouse kidney lysates stained with ARG10676 anti-IGFBP1 antibody at 0.5 μg/mL dilution.
1) rat kidney, 2) mouse kidney
