ARG59756

anti-HSD3B2 antibody

anti-HSD3B2 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Monkey

Overview

Product Description Rabbit Polyclonal antibody recognizes HSD3B2
Tested Reactivity Hu, Mk
Predict Reactivity Ms, Rat, Cow, Dog, Goat, Gpig, Hrs, Sheep
Tested Application IHC-P, WB
Specificity This antibody might cross-react to HSD3B1 protein based on sequence analysis (90%).
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name HSD3B2
Antigen Species Human
Immunogen Synthetic peptide around the N-terminal region of Human HSD3B2. (within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN)
Conjugation Un-conjugated
Alternate Names 3-beta-HSD adrenal and gonadal type; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II; HSDB; EC 1.1.1.145; HSD3B; EC 5.3.3.1; 3-beta-HSD II; 5; Progesterone reductase; SDR11E2; Delta-5-3-ketosteroid isomerase; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 85%; Dog: 93%; Goat: 85%; Guinea pig: 79%; Horse: 93%; Mouse: 79%; Rat: 86%; Sheep: 85%
Application Suggestion
Tested Application Dilution
IHC-P1:25
WB0.2 - 1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control 293T
Observed Size ~ 42 kDa

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 3284 Human HSD3B2

GeneID: 712686 Monkey HSD3B2

Swiss-port # P26439 Human 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2

Swiss-port # P27365 Monkey 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1

Gene Symbol HSD3B2
Gene Full Name hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2
Background The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads. Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2009]
Function 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. [UniProt]
Cellular Localization Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein. [UniProt]
Calculated MW 42 kDa

Images (3) Click the Picture to Zoom In

  • ARG59756 anti-HSD3B2 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Monkey adrenal gland stained with ARG59756 anti-HSD3B2 antibody at 1:25 dilution.

  • ARG59756 anti-HSD3B2 antibody WB image

    Western blot: 293T cell lysate stained with ARG59756 anti-HSD3B2 antibody at 0.2 - 1 µg/ml dilution.

  • ARG59756 anti-HSD3B2 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Monkey vagina stained with ARG59756 anti-HSD3B2 antibody at 1:25 dilution.