ARG58831

anti-GRK6 antibody

anti-GRK6 antibody for Western blot and Human,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes GRK6
Tested Reactivity Hu, Rat
Predict Reactivity Bov
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name GRK6
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 382-417 of Human GRK6 (QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR).
Conjugation Un-conjugated
Alternate Names G protein-coupled receptor kinase GRK6; G protein-coupled receptor kinase 6; EC 2.7.11.16; GPRK6

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 2870 Human GRK6

Swiss-port # P43250 Human G protein-coupled receptor kinase 6

Gene Symbol GRK6
Gene Full Name G protein-coupled receptor kinase 6
Background This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
Function Specifically phosphorylates the activated forms of G protein-coupled receptors. Such receptor phosphorylation initiates beta-arrestin-mediated receptor desensitization, internalization, and signaling events leading to their desensitization. Seems to be involved in the desensitization of D2-like dopamine receptors in striatum and chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis (By similarity). Phosphorylates rhodopsin (RHO) (in vitro) and a non G-protein-coupled receptor: LRP6 during Wnt signaling (in vitro). [UniProt]
Cellular Localization Membrane; Lipid-anchor. [UniProt]
Calculated MW 66 kDa
PTM It is uncertain whether palmitoylation is on Cys-561 and/or Cys-562 and/or Cys-565. [UniProt]

Images (1) Click the Picture to Zoom In

  • ARG58831 anti-GRK6 antibody WB image

    Western blot: 50 µg of Rat lung, 40 µg of HeLa, 40 µg of K562 and 40 µg of Jurkat cell lysates stained with ARG58831 anti-GRK6 antibody at 0.5 µg/ml dilution.