ARG58830
anti-GRK5 antibody
anti-GRK5 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
Product Description | Rabbit Polyclonal antibody recognizes GRK5 |
---|---|
Tested Reactivity | Hu, Ms, Rat |
Predict Reactivity | Chk |
Tested Application | IHC-P, WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | GRK5 |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to aa. 393-429 of Human GRK5 (KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK) |
Conjugation | Un-conjugated |
Alternate Names | G protein-coupled receptor kinase 5; EC 2.7.11.16; G protein-coupled receptor kinase GRK5; GPRK5 |
Application Instructions
Application Suggestion |
|
||||||
---|---|---|---|---|---|---|---|
Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
Preservative | 0.05% Sodium azide |
Stabilizer | 5% BSA |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | GRK5 |
Gene Full Name | G protein-coupled receptor kinase 5 |
Background | This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs). [provided by RefSeq, Jul 2008] |
Function | Serine/threonine kinase that phosphorylates preferentially the activated forms of a variety of G-protein-coupled receptors (GPCRs). Such receptor phosphorylation initiates beta-arrestin-mediated receptor desensitization, internalization, and signaling events leading to their down-regulation. Phosphorylates a variety of GPCRs, including adrenergic receptors, muscarinic acetylcholine receptors (more specifically Gi-coupled M2/M4 subtypes), dopamine receptors and opioid receptors. In addition to GPCRs, also phosphorylates various substrates: Hsc70-interacting protein/ST13, TP53/p53, HDAC5, and arrestin-1/ARRB1. Phosphorylation of ARRB1 by GRK5 inhibits G-protein independent MAPK1/MAPK3 signaling downstream of 5HT4-receptors. Phosphorylation of HDAC5, a repressor of myocyte enhancer factor 2 (MEF2) leading to nuclear export of HDAC5 and allowing MEF2-mediated transcription. Phosphorylation of TP53/p53, a crucial tumor suppressor, inhibits TP53/p53-mediated apoptosis. Phosphorylation of ST13 regulates internalization of the chemokine receptor. Phosphorylates rhodopsin (RHO) (in vitro) and a non G-protein-coupled receptor, LRP6 during Wnt signaling (in vitro). [UniProt] |
Cellular Localization | Cytoplasm. Nucleus. Cell membrane; Peripheral membrane protein. Predominantly localized at the plasma membrane; targeted to the cell surface through the interaction with phospholipids. Nucleus localization is regulated in a GPCR and Ca(2+)/calmodulin-dependent fashion. [UniProt] |
Calculated MW | 68 kDa |
PTM | Autophosphorylated. Autophosphorylation may play a critical role in the regulation of GRK5 kinase activity. [UniProt] |
Images (4) Click the Picture to Zoom In
-
ARG58830 anti-GRK5 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat cardiac muscle stained with ARG58830 anti-GRK5 antibody.
-
ARG58830 anti-GRK5 antibody WB image
Western blot: 50 µg of Rat lung, 40 µg of HeLa, 40 µg of HepG2 and 40 µg of SMMC-7721 cell lysates stained with ARG58830 anti-GRK5 antibody at 0.5 µg/ml dilution.
-
ARG58830 anti-GRK5 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse lung stained with ARG58830 anti-GRK5 antibody.
-
ARG58830 anti-GRK5 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human placenta stained with ARG58830 anti-GRK5 antibody.