ARG10645
anti-GPNMB antibody
anti-GPNMB antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes GPNMB |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb |
| Tested Application | IHC-P, WB |
| Specificity | 100% homologous to both isoforms of hGPNMB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | GPNMB |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminus of Human GPNMB. (DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVN) |
| Conjugation | Un-conjugated |
| Alternate Names | Transmembrane glycoprotein HGFIN; HGFIN; NMB; Transmembrane glycoprotein NMB |
Application Instructions
| Predict Reactivity Note | Homology Based On Immunogen Sequence: Cow: 100%; Dog: 79%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93% | ||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | IHC-P: Antigen Retrieval: Boil the paraffin sections in Sodium citrate, pH 6.0, for 20 mins. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | GPNMB |
| Gene Full Name | glycoprotein (transmembrane) nmb |
| Background | The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Function | Could be a melanogenic enzyme. [UniProt] |
| Calculated MW | 64 kDa |
Images (2) Click the Picture to Zoom In
-
ARG10645 anti-GPNMB antibody IHC-P image
Immunohistochemistry: Human lung tissue stained with ARG10645 anti-GPNMB antibody at 4.0 - 8.0 µg/ml dilution.
-
ARG10645 anti-GPNMB antibody WB image
Western blot: Human Fetal lung lysate stained with ARG10645 anti-GPNMB antibody at 1.0 µg/ml dilution.
