ARG58934
anti-GNAZ antibody
anti-GNAZ antibody for Western blot and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes GNAZ |
---|---|
Tested Reactivity | Hu |
Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | GNAZ |
Antigen Species | Human |
Immunogen | Synthetic peptide around the N-terminal region of Human GNAZ. (within the following region: LIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEIT) |
Conjugation | Un-conjugated |
Alternate Names | Guanine nucleotide-binding protein G(z) subunit alpha; G(x) alpha chain; Gz-alpha |
Application Instructions
Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% | ||||
---|---|---|---|---|---|
Application Suggestion |
|
||||
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
Positive Control | HepG2 |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links |
Swiss-port # P19086 Human Guanine nucleotide-binding protein G(z) subunit alpha |
---|---|
Gene Symbol | GNAZ |
Gene Full Name | guanine nucleotide binding protein (G protein), alpha z polypeptide |
Background | The protein encoded by this gene is a member of a G protein subfamily that mediates signal transduction in pertussis toxin-insensitive systms. This encoded protein may play a role in maintaining the ionic balance of perilymphatic and endolymphatic cochlear fluids. [provided by RefSeq, Jul 2008] |
Function | Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. [UniProt] |
Cellular Localization | Membrane; Lipid-anchor. [UniProt] |
Calculated MW | 41 kDa |
Images (2) Click the Picture to Zoom In