ARG43266
anti-GNAS antibody
anti-GNAS antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse
Publication1
Overview
| Product Description | Rabbit Polyclonal antibody recognizes GNAS |
|---|---|
| Tested Reactivity | Hu, Ms |
| Predict Reactivity | Cow, Rat, Pig, Rb |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | GNAS |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human GNAS. (within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV) |
| Conjugation | Un-conjugated |
| Alternate Names | AHO; GSA; GSP; POH; GPSA; NESP; SCG6; SgVI; GNAS1; C20orf45; Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas; Adenylate cyclase-stimulating G alpha protein; Extra large alphas protein; XLalphas |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based on Immunogen Sequence: Human, Mouse, Rat, Pig: 100% Rabbit, Cow: 93% |
||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Positive Control | MCF7, Mouse heart | ||||||
| Observed Size | 41 ~ 44 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Purification with Protein A. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | GNAS |
| Gene Full Name | GNAS complex locus |
| Background | This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contain a differentially methylated region (DMR) at their 5' exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript is produced from an overlapping locus on the opposite strand. One of the transcripts produced from this locus, and the antisense transcript, are paternally expressed noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. [provided by RefSeq, Aug 2012] |
| Function | Guanine nucleotide-binding proteins (G proteins) function as transducers in numerous signaling pathways controlled by G protein-coupled receptors (GPCRs). Signaling involves the activation of adenylyl cyclases, resulting in increased levels of the signaling molecule cAMP. GNAS functions downstream of several GPCRs, including beta-adrenergic receptors. XLas isoforms interact with the same set of receptors as GNAS isoforms (By similarity). [UniProt] |
| Cellular Localization | Cell membrane; Peripheral membrane protein. Cell projection, ruffle. Note=Predominantly associated with cell membrane ruffles. [UniProt] |
| Calculated MW | 44 kDa |
| PTM | Binds keratan sulfate chains. May be proteolytically processed to give rise to a number of active peptides. [UniProt] |
Images (5) Click the Picture to Zoom In
-
ARG43266 anti-GNAS antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human kidney tissue stained with ARG43266 anti-GNAS antibody.
-
ARG43266 anti-GNAS antibody WB image
Western blot: MCF7 cell lysate stained with ARG43266 anti-GNAS antibody at 1 µg/ml dilution.
-
ARG43266 anti-GNAS antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human lung tissue stained with ARG43266 anti-GNAS antibody.
-
ARG43266 anti-GNAS antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human alveolar tissue (epithelial cells of renal tubule) stained with ARG43266 anti-GNAS antibody at 4 - 8 µg/ml dilution.
-
ARG43266 anti-GNAS antibody WB image
Western blot: Mouse heart lysate stained with ARG43266 anti-GNAS antibody at 1 µg/ml dilution.
Specific References
Inter- and trans-generational impacts of real-world PM2.5 exposure on male-specific primary hypogonadism
WB, IHC-P / Mouse
