ARG10606

anti-GNAQ antibody

anti-GNAQ antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes GNAQ
Tested Reactivity Hu, Ms, Rat
Tested Application FACS, ICC/IF, IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name GNAQ
Antigen Species Human
Immunogen Synthetic peptide from Human GNAQ protein. (KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND)
Conjugation Un-conjugated
Alternate Names GAQ; SWS; CMC1; G-ALPHA-q; Guanine nucleotide-binding protein G(q) subunit alpha; Guanine nucleotide-binding protein alpha-q

Application Instructions

Application Suggestion
Tested Application Dilution
FACS1 - 3 µg/10^6 cells
ICC/IF1 - 5 µg/ml
IHC-P1 - 5 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: Boil tissue sections in 10 mM Citrate buffer (pH 6.0) for 20 min
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer PBS, 0.025% Sodium azide and 2.5% BSA.
Preservative 0.025% Sodium azide
Stabilizer 2.5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 14682 Mouse GNAQ

GeneID: 2776 Human GNAQ

GeneID: 81666 Rat GNAQ

Gene Symbol GNAQ
Gene Full Name guanine nucleotide binding protein (G protein), q polypeptide
Background This locus encodes a guanine nucleotide-binding protein. The encoded protein, an alpha subunit in the Gq class, couples a seven-transmembrane domain receptor to activation of phospolipase C-beta. Mutations at this locus have been associated with problems in platelet activation and aggregation. A related pseudogene exists on chromosome 2.[provided by RefSeq, Nov 2010]
Function Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Regulates B-cell selection and survival and is required to prevent B-cell-dependent autoimmunity. Regulates chemotaxis of BM-derived neutrophils and dendritic cells (in vitro) (By similarity). [UniProt]
Calculated MW 42 kDa
PTM (Microbial infection) Deamidated at Gln-209 by Photorhabdus asymbiotica toxin PAU_02230, blocking GTP hydrolysis of heterotrimeric GNAQ or GNA11 and G-alphai (GNAI1, GNAI2 or GNAI3) proteins, thereby activating RhoA.

Images (6) Click the Picture to Zoom In

  • ARG10606 anti-GNAQ antibody ICC/IF image

    Immunofluorescence: A431 cells stained with ARG10606 anti-GNAQ antibody (red). DAPI (blue) for nuclear staining.

  • ARG10606 anti-GNAQ antibody IHC-P image

    Immunohistochemistry: Formalin-fixed and Paraffin-embedded Human prostate cancer tissue stained with ARG10606 anti-GNAQ antibody.

  • ARG10606 anti-GNAQ antibody WB image

    Western blot: 1) Rat ovary, 2) Rat testis, 3) Mouse testis, 4) Human 22RV1 and 5) Human SKOV lysate stained with ARG10606 anti-GNAQ antibody.

  • ARG10606 anti-GNAQ antibody FACS image

    Flow Cytometry: A431 cells were blocked with goat sera and stained with ARG10606 anti-GNAQ antibody at 1 µg/10^6 cells (blue); Cells alone (red); Isotype control (green).

  • ARG10606 anti-GNAQ antibody IHC-P image

    Immunohistochemistry: Formalin-fixed and Paraffin-embedded Mouse testis tissue stained with ARG10606 anti-GNAQ antibody.

  • ARG10606 anti-GNAQ antibody IHC-P image

    Immunohistochemistry: Formalin-fixed and Paraffin-embedded Rat ovary tissue stained with ARG10606 anti-GNAQ antibody.