ARG58933
anti-GM2A antibody
anti-GM2A antibody for Western blot and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes GM2A |
---|---|
Tested Reactivity | Hu |
Predict Reactivity | Gpig |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | GM2A |
Antigen Species | Human |
Immunogen | Synthetic peptide around the N-terminal region of Human GM2A. (within the following region: SWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDL) |
Conjugation | Un-conjugated |
Alternate Names | Ganglioside GM2 activator; SAP-3; Cerebroside sulfate activator protein; GM2-AP; Sphingolipid activator protein 3 |
Application Instructions
Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Guinea pig: 83% | ||||
---|---|---|---|---|---|
Application Suggestion |
|
||||
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
Positive Control | HeLa |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | GM2A |
Gene Full Name | GM2 ganglioside activator |
Background | This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2009] |
Function | The large binding pocket can accommodate several single chain phospholipids and fatty acids, GM2A also exhibits some calcium-independent phospholipase activity (By similarity). Binds gangliosides and stimulates ganglioside GM2 degradation. It stimulates only the breakdown of ganglioside GM2 and glycolipid GA2 by beta-hexosaminidase A. It extracts single GM2 molecules from membranes and presents them in soluble form to beta-hexosaminidase A for cleavage of N-acetyl-D-galactosamine and conversion to GM3. [UniProt] |
Cellular Localization | Lysosome. [UniProt] |
Calculated MW | 21 kDa |
PTM | The serines in positions 32 and 33 are absent in 80% of the sequenced protein. [UniProt] |
Images (1) Click the Picture to Zoom In