ARG58756
anti-Fibromodulin antibody
anti-Fibromodulin antibody for ICC/IF,IHC-Frozen sections,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Horse
Overview
Product Description | Rabbit Polyclonal antibody recognizes Fibromodulin |
---|---|
Tested Reactivity | Hu, Hrs |
Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Rb |
Tested Application | ICC/IF, IHC-Fr, IHC-P, WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | Fibromodulin |
Antigen Species | Human |
Immunogen | Synthetic peptide around the N-terminal region of Human Fibromodulin. (within the following sequence: VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER) |
Conjugation | Un-conjugated |
Alternate Names | Collagen-binding 59 kDa protein; SLRR2E; Fibromodulin; Keratan sulfate proteoglycan fibromodulin; KSPG fibromodulin; FM |
Application Instructions
Predict Reactivity Note | Predicted homology based on immunogen sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
Application Suggestion |
|
||||||||||
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | FMOD |
Gene Full Name | fibromodulin |
Background | Fibromodulin belongs to the family of small interstitial proteoglycans. The encoded protein possesses a central region containing leucine-rich repeats with 4 keratan sulfate chains, flanked by terminal domains containing disulphide bonds. Owing to the interaction with type I and type II collagen fibrils and in vitro inhibition of fibrillogenesis, the encoded protein may play a role in the assembly of extracellular matrix. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix. Sequence variations in this gene may be associated with the pathogenesis of high myopia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013] |
Function | Affects the rate of fibrils formation. May have a primary role in collagen fibrillogenesis (By similarity). [UniProt] |
Calculated MW | 43 kDa |
PTM | Binds keratan sulfate chains. [UniProt] |
Images (3) Click the Picture to Zoom In
-
ARG58756 anti-Fibromodulin antibody WB image
Western blot: HeLa cell lysate stained with ARG58756 anti-Fibromodulin antibody at 1 µg/ml dilution.
-
ARG58756 anti-Fibromodulin antibody WB image
Western blot: U937 whole cell lysate stained with ARG58756 anti-Fibromodulin antibody at 1 µg/ml dilution.
-
ARG58756 anti-Fibromodulin antibody WB image
Western blot: Equine cartilage explant lysate stained with ARG58756 anti-Fibromodulin antibody at 1:500 dilution.