ARG58712
anti-FMO2 antibody
anti-FMO2 antibody for Western blot and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes FMO2 |
---|---|
Tested Reactivity | Hu |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | FMO2 |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to aa. 78-115 of Human FMO2 (FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK). |
Conjugation | Un-conjugated |
Alternate Names | Pulmonary flavin-containing monooxygenase 2; FMO 1B1; Dimethylaniline oxidase 2; FMO1B1; Dimethylaniline monooxygenase [N-oxide-forming] 2; EC 1.14.13.8; FMO 2 |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
Preservative | 0.05% Sodium azide |
Stabilizer | 5% BSA |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links |
Swiss-port # Q99518 Human Dimethylaniline monooxygenase [N-oxide-forming] 2 |
---|---|
Gene Symbol | FMO2 |
Gene Full Name | flavin containing monooxygenase 2 (non-functional) |
Background | This gene encodes a flavin-containing monooxygenase family member. It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014] |
Function | Catalyzes the N-oxidation of certain primary alkylamines to their oximes via an N-hydroxylamine intermediate. Inactive toward certain tertiary amines, such as imipramine or chloropromazine. Can catalyze the S-oxidation of methimazole. The truncated form is catalytically inactive. [UniProt] |
Cellular Localization | Microsome membrane. Endoplasmic reticulum membrane. [UniProt] |
Calculated MW | 61 kDa |
PTM | The truncated form is probably unable to fold correctly and is rapidly degraded. FMO2*1 is sumoylated at 'Lys-492'. [UniProt] |
Images (1) Click the Picture to Zoom In