ARG59445
anti-FDCSP antibody
anti-FDCSP antibody for IHC-Formalin-fixed paraffin-embedded sections and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes FDCSP |
|---|---|
| Tested Reactivity | Hu |
| Tested Application | IHC-P |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | FDCSP |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 18-51 of Human FDCSP. (FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR) |
| Conjugation | Un-conjugated |
| Alternate Names | C4orf7; FDC-SP; FDC secreted protein; Follicular dendritic cell secreted peptide |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q8NFU4 Human Follicular dendritic cell secreted peptide |
|---|---|
| Gene Symbol | FDCSP |
| Gene Full Name | follicular dendritic cell secreted protein |
| Background | This gene encodes a small secreted protein that is expressed in follicular dendritic cells. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion. [provided by RefSeq, Dec 2011] |
| Function | Can bind to the surface of B-lymphoma cells, but not T-lymphoma cells, consistent with a function as a secreted mediator acting upon B-cells. [UniProt] |
| Cellular Localization | Secreted. [UniProt] |
| Calculated MW | 10 kDa |
| PTM | O-glycosylated with core 1 or possibly core 8 glycans. [UniProt] |
Images (1) Click the Picture to Zoom In
-
ARG59445 anti-FDCSP antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human tonsil tissues. Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59445 anti-FDCSP antibody at 1 µg/ml, overnight at 4°C.
