ARG58594

anti-ERV3 antibody

anti-ERV3 antibody for Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes ERV3
Tested Reactivity Hu
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name ERV3
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 575-604 of Human ERV3. (LELDDEGKVIKEITAKIQKLAHIPVQTWKG).
Conjugation Un-conjugated
Alternate Names ERV3 envelope protein; Endogenous retrovirus group 3 member 1 Env polyprotein; HERV-R envelope protein; HERV-R; envR; ERV3-1 envelope protein; SU; ERV-R envelope protein; HERV-R_7q21.2 provirus ancestral Env polyprotein; ERV3; ERVR; Envelope polyprotein; ERV-3 envelope protein; HERVR; ERV-R; TM

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 2086 Human ERV3-1

Swiss-port # Q14264 Human Endogenous retrovirus group 3 member 1 Env polyprotein

Gene Symbol ERV3-1
Gene Full Name endogenous retrovirus group 3, member 1
Background The human genome includes many retroelements including the human endogenous retroviruses (HERVs). ERV3, one of the most studied HERVs, is thought to have integrated 30 to 40 million years ago and is present in higher primates with the exception of gorillas. Taken together, the observation of genome conservation, the detection of transcript expression, and the presence of conserved ORFs is circumstantial evidence for a functional role. A functional role is also suggested by the observation that downregulation of ERV3 is reported in choriocarcinoma. [provided by RefSeq, Jul 2008]
Function Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has lost its fusogenic properties. It can inhibit cell growth through decrease expression of cyclin B1 and increased expression of p21 in vitro.

SU mediates receptor recognition.

TM anchors the envelope heterodimer to the viral membrane through one transmembrane domain. The other hydrophobic domain, called fusion peptide, mediates fusion of the viral membrane with the target cell membrane (By similarity). [UniProt]
Cellular Localization Virion. [UniProt]
Calculated MW 68 kDa
PTM Specific enzymatic cleavages in vivo yield the mature SU and TM proteins (By similarity). Has been mainly detected in vivo as an 65 kDa unprocessed polyprotein precursor.

The CXXC motif is highly conserved across a broad range of retroviral envelope proteins. It is thought to participate in the formation of a labile disulfide bond possibly with the CX6CC motif present in the transmembrane protein. Isomerization of the intersubunit disulfide bond to an SU intrachain disulfide bond is thought to occur upon receptor recognition in order to allow membrane fusion (By similarity). [UniProt]

Images (1) Click the Picture to Zoom In

  • ARG58594 anti-ERV3 antibody WB image

    Western blot: 40 µg of HeLa, 22RV1, HepG2, SKOV, A431 and HT1080 whole cell lysates stained with ARG58594 anti-ERV3 antibody at 0.5 µg/ml dilution.