ARG58550
anti-CTRB1 antibody
anti-CTRB1 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes CTRB1 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Pig, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | CTRB1 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human CTRB1. (within the following sequence: FKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCAT) |
| Conjugation | Un-conjugated |
| Alternate Names | CTRB |
Application Instructions
| Predict Reactivity Note | Predicted homology based on immunogen sequence: Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 86%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Human muscle |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Gene Symbol | CTRB1 |
|---|---|
| Gene Full Name | chymotrypsinogen B1 |
| Background | This gene encodes a member of the serine protease family of enzymes and forms a principal precursor of the pancreatic proteolytic enzymes. The encoded preproprotein is synthesized in the acinar cells of the pancreas and secreted into the small intestine where it undergoes proteolytic activation to generate a functional enzyme. This gene is located adjacent to a related chymotrypsinogen gene. This gene encodes distinct isoforms, some or all of which may undergo similar processing to generate the mature protein. [provided by RefSeq, Jul 2016] |
| Calculated MW | 28 kDa |
Images (1) Click the Picture to Zoom In
-
ARG58550 anti-CTRB1 antibody WB image
Western blot: Human muscle lysate stained with ARG58550 anti-CTRB1 antibody at 0.2 - 1 µg/ml dilution.
