ARG40152
anti-CRISPLD2 antibody
anti-CRISPLD2 antibody for Western blot and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes CRISPLD2 |
---|---|
Tested Reactivity | Hu |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | CRISPLD2 |
Antigen Species | Human |
Immunogen | Synthetic peptide around the N-terminal region of Human CRISPLD2. (within the following region: MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA) |
Conjugation | Un-conjugated |
Alternate Names | CRISP11; CRISP-11; LCCL domain-containing cysteine-rich secretory protein 2; LCRISP2; Cysteine-rich secretory protein LCCL domain-containing 2; Cysteine-rich secretory protein 11 |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
Positive Control | Jurkat |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links |
Swiss-port # Q9H0B8 Human Cysteine-rich secretory protein LCCL domain-containing 2 |
---|---|
Gene Symbol | CRISPLD2 |
Gene Full Name | cysteine-rich secretory protein LCCL domain containing 2 |
Function | Promotes matrix assembly. [UniProt] |
Cellular Localization | Secreted. [UniProt] |
Calculated MW | 56 kDa |
Images (2) Click the Picture to Zoom In
-
ARG40152 anti-CRISPLD2 antibody WB image
Western blot: Jurkat cell lysate stained with ARG40152 anti-CRISPLD2 antibody at 0.2 - 1 µg/ml dilution.
-
ARG40152 anti-CRISPLD2 antibody WB image
Western blot: 40 µg of Human lung fibroblast cell lysate stained with ARG40152 anti-CRISPLD2 antibody at 1: 2000 dilution.