ARG43054
anti-CRB1 antibody
anti-CRB1 antibody for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes CRB1 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | FACS, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | CRB1 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human CRB1. (FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ) |
| Conjugation | Un-conjugated |
| Alternate Names | LCA8; Protein crumbs homolog 1; RP12 |
Application Instructions
| Application Suggestion |
|
||||||||
|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | CRB1 |
| Gene Full Name | crumbs family member 1, photoreceptor morphogenesis associated |
| Background | This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternate splicing results in multiple transcript variants, some protein coding and some non-protein coding. [provided by RefSeq, Apr 2012] |
| Function | Plays a role in photoreceptor morphogenesis in the retina. May maintain cell polarization and adhesion. [UniProt] |
| Cellular Localization | Isoform 1: Apical cell membrane; Single-pass type I membrane protein. Note=Distributed at the apical membrane of all retinal epithelial cells. Located in the apical membrane of the adherens junction in outer limiting membrane (OLM) of the retina. Isoform 2: Secreted. [UniProt] |
| Calculated MW | 154 kDa |
| PTM | Extensively glycosylated. [UniProt] |
Images (6) Click the Picture to Zoom In
-
ARG43054 anti-CRB1 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse testis tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43054 anti-CRB1 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG43054 anti-CRB1 antibody WB image
Western blot: 50 µg of sample under reducing conditions. HEK293 and U-87MG whole cell lysates stained with ARG43054 anti-CRB1 antibody at 0.5 µg/ml dilution, overnight at 4°C.
-
ARG43054 anti-CRB1 antibody FACS image
Flow Cytometry: U87 cells were blocked with 10% normal goat serum and then stained with ARG43054 anti-CRB1 antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
-
ARG43054 anti-CRB1 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human testis cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43054 anti-CRB1 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG43054 anti-CRB1 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat testis tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43054 anti-CRB1 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG43054 anti-CRB1 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human glioma tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43054 anti-CRB1 antibody at 1 µg/ml dilution, overnight at 4°C.
