ARG58685
anti-CHRNA3 antibody
anti-CHRNA3 antibody for Flow cytometry,Western blot and Human,Mouse
Overview
| Product Description | Rabbit Polyclonal antibody recognizes CHRNA3 |
|---|---|
| Tested Reactivity | Hu, Ms |
| Tested Application | FACS, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | CHRNA3 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human CHRNA3 (DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD). |
| Conjugation | Un-conjugated |
| Alternate Names | LNCR2; NACHRA3; Neuronal acetylcholine receptor subunit alpha-3; PAOD2 |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # P32297 Human Neuronal acetylcholine receptor subunit alpha-3 Swiss-port # Q8R4G9 Mouse Neuronal acetylcholine receptor subunit alpha-3 |
|---|---|
| Gene Symbol | CHRNA3 |
| Gene Full Name | cholinergic receptor, nicotinic, alpha 3 (neuronal) |
| Background | This locus encodes a member of the nicotinic acetylcholine receptor family of proteins. Members of this family of proteins form pentameric complexes comprised of both alpha and beta subunits. This locus encodes an alpha-type subunit, as it contains characteristic adjacent cysteine residues. The encoded protein is a ligand-gated ion channel that likely plays a role in neurotransmission. Polymorphisms in this gene have been associated with an increased risk of smoking initiation and an increased susceptibility to lung cancer. Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2009] |
| Function | After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [UniProt] |
| Cellular Localization | Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. [UniProt] |
| Calculated MW | 57 kDa |
Images (3) Click the Picture to Zoom In
-
ARG58685 anti-CHRNA3 antibody FACS image
Flow Cytometry: U251 cells were blocked with 10% normal goat serum, and then stained with ARG58685 anti-CHRNA3 antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
-
ARG58685 anti-CHRNA3 antibody WB image
Western blot: 50 µg of HeLa whole cell lysates, MDA-MB-453 whole cell lysates, Jurkat whole cell lysates, HepG2 whole cell lysates, SK-OV-3 whole cell lysates, PANC-1 whole cell lysates and Mouse thymus stained with ARG58685 anti-CHRNA3 antibody at 0.5 µg/ml, overnight at 4°C, under reducing conditions.
-
ARG58685 anti-CHRNA3 antibody FACS image
Flow Cytometry: U-87 cells were blocked with 10% normal goat serum, and then stained with ARG58685 anti-CHRNA3 antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
