ARG41100
anti-CD41 antibody
anti-CD41 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes CD41 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | CD41 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 677-711 of Human CD41. (EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN) |
| Conjugation | Un-conjugated |
| Alternate Names | GTA; GT; GPalpha IIb; PPP1R93; CD41; BDPLT2; BDPLT16; GP2B; Integrin alpha-IIb; GPIIb; Platelet membrane glycoprotein IIb; HPA3; CD antigen CD41; CD41B |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Observed Size | 113 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | ITGA2B |
| Gene Full Name | integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) |
| Background | ITGA2B encodes integrin alpha chain 2b. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibronectin receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling. [provided by RefSeq, Jul 2008] |
| Function | Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial cell surface. [UniProt] |
| Cellular Localization | Membrane; Single-pass type I membrane protein. [UniProt] |
| Calculated MW | 113 kDa |
Images (5) Click the Picture to Zoom In
-
ARG41100 anti-CD41 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human mammary cancer tissue stained with ARG41100 anti-CD41 antibody.
-
ARG41100 anti-CD41 antibody WB image
Western blot: 50 μg of samples under reducing conditions. HEK293 and HepG2 whole cell lysates stained with ARG41100 anti-CD41 antibody at 0.5 μg/ml, overnight at 4°C.
-
ARG41100 anti-CD41 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse lung tissue stained with ARG41100 anti-CD41 antibody.
-
ARG41100 anti-CD41 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat lung tissue stained with ARG41100 anti-CD41 antibody.
-
ARG41100 anti-CD41 antibody WB image
Western blot: 50 µg of Rat lung, Rat liver and Mouse spleen lysates stained with ARG41100 anti-CD41 antibody at 0.5 µg/ml dilution.
