ARG40369
anti-CD119 / IFN gamma R1 antibody
anti-CD119 / IFN gamma R1 antibody for Flow cytometry,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes CD119 / IFN gamma R1 |
|---|---|
| Tested Reactivity | Hu |
| Tested Application | FACS, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | CD119 / IFN gamma R1 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 108-147 of Human CD119 / IFN gamma R1. (QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH) |
| Conjugation | Un-conjugated |
| Alternate Names | IMD27B; IMD27A; CD119; CD antigen CD119; CDw119; Interferon gamma receptor 1; IFNGR; IFN-gamma receptor 1; IFN-gamma-R1 |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Observed Size | 95 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | IFNGR1 |
| Gene Full Name | interferon gamma receptor 1 |
| Background | This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection. [provided by RefSeq, Jul 2008] |
| Function | Receptor for interferon gamma. Two receptors bind one interferon gamma dimer. [UniProt] |
| Cellular Localization | Cell membrane; Single-pass type I membrane protein. [UniProt] |
| Calculated MW | 54 kDa |
| PTM | Phosphorylated at Ser/Thr residues. [UniProt] |
Images (2) Click the Picture to Zoom In
-
ARG40369 anti-CD119 / IFN gamma R1 antibody WB image
Western blot: 50 µg of sample under reducing conditions. HepG2 whole cell lysate stained with ARG40369 anti-CD119 / IFN gamma R1 antibody at 0.5 µg/ml, overnight at 4°C.
-
ARG40369 anti-CD119 / IFN gamma R1 antibody FACS image
Flow Cytometry: SiHa cells were blocked with 10% normal goat serum and then stained with ARG40369 anti-CD119 / IFN gamma R1 antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
