ARG40196
anti-CD105 / Endoglin antibody
anti-CD105 / Endoglin antibody for Western blot and Human,Mouse,Rat
Publication1
Overview
| Product Description | Rabbit Polyclonal antibody recognizes CD105 / Endoglin |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | CD105 / Endoglin |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 258-297 of Human CD105 / Endoglin. (YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ) |
| Conjugation | Un-conjugated |
| Alternate Names | CD antigen CD105; HHT1; Endoglin; ORW1; END |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | ENG |
| Gene Full Name | endoglin |
| Background | This gene encodes a homodimeric transmembrane protein which is a major glycoprotein of the vascular endothelium. This protein is a component of the transforming growth factor beta receptor complex and it binds to the beta1 and beta3 peptides with high affinity. Mutations in this gene cause hereditary hemorrhagic telangiectasia, also known as Osler-Rendu-Weber syndrome 1, an autosomal dominant multisystemic vascular dysplasia. This gene may also be involved in preeclampsia and several types of cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2013] |
| Function | Major glycoprotein of vascular endothelium. Involved in the regulation of angiogenesis. May play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors. Acts as TGF-beta coreceptor and is involved in the TGF-beta/BMP signaling cascade. Required for GDF2/BMP9 signaling through SMAD1 in endothelial cells and modulates TGF-beta1 signaling through SMAD3. [UniProt] |
| Cellular Localization | Cell membrane; Single-pass type I membrane protein. [UniProt] |
| Calculated MW | 71 kDa |
Images (1) Click the Picture to Zoom In
-
ARG40196 anti-CD105 / Endoglin antibody WB image
Western blot: 50 µg of samples under reducing conditions. Rat lung, Mouse lung and HeLa whole cell lysates stained with ARG40196 anti-CD105 / Endoglin antibody at 0.5 µg/ml overnight at 4°C.
Specific References
Increased cGAS/STING signaling components in patients with Mooren's ulcer
WB / Human
