ARG58374
anti-C4BPB antibody
anti-C4BPB antibody for IHC-Formalin-fixed paraffin-embedded sections and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes C4BPB |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Dog, Pig |
| Tested Application | IHC-P |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | C4BPB |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human C4BPB. (within the following sequence: CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV) |
| Conjugation | Un-conjugated |
| Alternate Names | C4b-binding protein beta chain; C4BP |
Application Instructions
| Predict Reactivity Note | Predicted homology based on immunogen sequence: Dog: 86%; Pig: 93% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Human liver |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | C4BPB |
| Gene Full Name | complement component 4 binding protein, beta |
| Background | This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Alternative splicing gives rise to multiple transcript variants. [provided by RefSeq, Jul 2008] |
| Function | Controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. It also interacts with anticoagulant protein S and with serum amyloid P component. The beta chain binds protein S. [UniProt] |
| Calculated MW | 28 kDa |
Images (1) Click the Picture to Zoom In
-
ARG58374 anti-C4BPB antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human kidney stained with ARG58374 anti-C4BPB antibody.
