ARG40847
anti-C Reactive Protein antibody
anti-C Reactive Protein antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse
Overview
| Product Description | Rabbit Polyclonal antibody recognizes C Reactive Protein |
|---|---|
| Tested Reactivity | Hu, Ms |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | C Reactive Protein |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human CRP. (QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA) |
| Conjugation | Un-conjugated |
| Alternate Names | 1-205; PTX1; C-reactive protein |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | CRP |
| Gene Full Name | C-reactive protein, pentraxin-related |
| Background | The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli. [provided by RefSeq, Sep 2009] |
| Function | Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. [UniProt] |
| Cellular Localization | Secreted. [UniProt] |
| Calculated MW | 25 kDa |
Images (4) Click the Picture to Zoom In
-
ARG40847 anti-C Reactive Protein antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human liver cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40847 anti-C Reactive Protein antibody at 1 µg/ml, overnight at 4°C.
-
ARG40847 anti-C Reactive Protein antibody WB image
Western blot: 50 µg of samples under reducing conditions. U-937 and A431 whole cell lysates stained with ARG40847 anti-C Reactive Protein antibody at 0.5 µg/ml, overnight at 4°C.
-
ARG40847 anti-C Reactive Protein antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse liver tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40847 anti-C Reactive Protein antibody at 1 µg/ml, overnight at 4°C.
-
ARG40847 anti-C Reactive Protein antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse small intestine tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40847 anti-C Reactive Protein antibody at 1 µg/ml, overnight at 4°C.
