ARG41412

anti-Butyrylcholinesterase antibody

anti-Butyrylcholinesterase antibody for IHC-Formalin-fixed paraffin-embedded sections and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes Butyrylcholinesterase
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Pig, Rb, Sheep
Tested Application IHC-P
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name Butyrylcholinesterase
Antigen Species Human
Immunogen Synthetic peptide around the N-terminal region of Human Butyrylcholinesterase. (within the following region: SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ)
Conjugation Un-conjugated
Alternate Names Butyrylcholine esterase; CHE2; CHE1; Choline esterase II; EC 3.1.1.8; Acylcholine acylhydrolase; E1; Cholinesterase; Pseudocholinesterase

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 93%; Horse: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Application Suggestion
Tested Application Dilution
IHC-PAssay-dependent
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control HepG2

Properties

Form Liquid
Purification Purification with Protein A.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent within range: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 590 Human BCHE

Swiss-port # P06276 Human Cholinesterase

Gene Symbol BCHE
Gene Full Name butyrylcholinesterase
Background Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage. [provided by RefSeq, Jul 2008]
Function Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters. [UniProt]
Cellular Localization Secreted. [UniProt]
Calculated MW 68 kDa
PTM N-glycosylated. No other PTM detected (PubMed:20946535). The major N-glycan structures are of the complex diantennary type with 1 and 2 N-acetylneuraminic acid molecules (Neu5Ac) making up approximately 33% and 47% of the total N-glycans, respectively. Only low amounts of fucosylated diantennary N-glycans are detected (approximately 2%). Triantennary N-glycans with or without fucose amount to approximately 13%, whereas 5% of the total N-glycans are of the oligomannosidic or hybrid type. [UniProt]

Images (1) Click the Picture to Zoom In

  • ARG41412 anti-Butyrylcholinesterase antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human lung tissue stained with ARG41412 anti-Butyrylcholinesterase antibody.