ARG41412
anti-Butyrylcholinesterase antibody
anti-Butyrylcholinesterase antibody for IHC-Formalin-fixed paraffin-embedded sections and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes Butyrylcholinesterase |
---|---|
Tested Reactivity | Hu |
Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Pig, Rb, Sheep |
Tested Application | IHC-P |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | Butyrylcholinesterase |
Antigen Species | Human |
Immunogen | Synthetic peptide around the N-terminal region of Human Butyrylcholinesterase. (within the following region: SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ) |
Conjugation | Un-conjugated |
Alternate Names | Butyrylcholine esterase; CHE2; CHE1; Choline esterase II; EC 3.1.1.8; Acylcholine acylhydrolase; E1; Cholinesterase; Pseudocholinesterase |
Application Instructions
Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 93%; Horse: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100% | ||||
---|---|---|---|---|---|
Application Suggestion |
|
||||
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
Positive Control | HepG2 |
Properties
Form | Liquid |
---|---|
Purification | Purification with Protein A. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent within range: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | BCHE |
Gene Full Name | butyrylcholinesterase |
Background | Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage. [provided by RefSeq, Jul 2008] |
Function | Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters. [UniProt] |
Cellular Localization | Secreted. [UniProt] |
Calculated MW | 68 kDa |
PTM | N-glycosylated. No other PTM detected (PubMed:20946535). The major N-glycan structures are of the complex diantennary type with 1 and 2 N-acetylneuraminic acid molecules (Neu5Ac) making up approximately 33% and 47% of the total N-glycans, respectively. Only low amounts of fucosylated diantennary N-glycans are detected (approximately 2%). Triantennary N-glycans with or without fucose amount to approximately 13%, whereas 5% of the total N-glycans are of the oligomannosidic or hybrid type. [UniProt] |
Images (1) Click the Picture to Zoom In