ARG42660
anti-BMPER / Crossveinless 2 antibody
anti-BMPER / Crossveinless 2 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes BMPER / Crossveinless 2 |
---|---|
Tested Reactivity | Hu |
Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Pig, Rb |
Tested Application | IHC-P, WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | BMPER / Crossveinless 2 |
Antigen Species | Human |
Immunogen | Synthetic peptide around the C-terminal region of Human BMPER / Crossveinless 2. (Within the following region: NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV) |
Conjugation | Un-conjugated |
Alternate Names | hCV2; CV-2; CV2; BMP-binding endothelial regulator protein; Protein crossveinless-2; CRIM3; Bone morphogenetic protein-binding endothelial cell precursor-derived regulator |
Application Instructions
Predict Reactivity Note | Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea pig: 93%; Horse: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 79% | ||||||
---|---|---|---|---|---|---|---|
Application Suggestion |
|
||||||
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
Positive Control | Human fetal heart |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links |
Swiss-port # Q8N8U9 Human BMP-binding endothelial regulator protein |
---|---|
Gene Symbol | BMPER |
Gene Full Name | BMP binding endothelial regulator |
Background | This gene encodes a secreted protein that interacts with, and inhibits bone morphogenetic protein (BMP) function. It has been shown to inhibit BMP2- and BMP4-dependent osteoblast differentiation and BMP-dependent differentiation of the chondrogenic cells. Mutations in this gene are associated with a lethal skeletal disorder, diaphanospondylodysostosis. [provided by RefSeq, Dec 2011] |
Function | Inhibitor of bone morphogenetic protein (BMP) function, it may regulate BMP responsiveness of osteoblasts and chondrocytes. [UniProt] |
Cellular Localization | Secreted. [UniProt] |
Calculated MW | 76 kDa |
Images (2) Click the Picture to Zoom In
-
ARG42660 anti-BMPER / Crossveinless 2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human lung (respiratory epethelium tissue) stained with ARG42660 anti-BMPER / Crossveinless 2 antibody at 5 µg/ml dilution.
-
ARG42660 anti-BMPER / Crossveinless 2 antibody WB image
Western blot: Human fetal heart lysate stained with ARG42660 anti-BMPER / Crossveinless 2 antibody at 1 µg/ml dilution.