ARG41307
anti-BHLHB2 antibody
anti-BHLHB2 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes BHLHB2 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Sheep |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | BHLHB2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human BHLHB2. (within the following region: SEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDE) |
| Conjugation | Un-conjugated |
| Alternate Names | Enhancer-of-split and hairy-related protein 2; bHLHb2; Differentially expressed in chondrocytes protein 1; bHLHe40; HLHB2; Class B basic helix-loop-helix protein 2; BHLHB2; Class E basic helix-loop-helix protein 40; Stra14; STRA13; Stimulated by retinoic acid gene 13 protein; DEC1; SHARP-2 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 92%; Dog: 93%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 92% | ||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Positive Control | Human fetal lung |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # O14503 Human Class E basic helix-loop-helix protein 40 |
|---|---|
| Gene Symbol | BHLHE40 |
| Gene Full Name | basic helix-loop-helix family, member e40 |
| Background | This gene encodes a basic helix-loop-helix protein expressed in various tissues. The encoded protein can interact with ARNTL or compete for E-box binding sites in the promoter of PER1 and repress CLOCK/ARNTL's transactivation of PER1. This gene is believed to be involved in the control of circadian rhythm and cell differentiation. [provided by RefSeq, Feb 2014] |
| Function | Transcriptional repressor involved in the regulation of the circadian rhythm by negatively regulating the activity of the clock genes and clock-controlled genes. Acts as the negative limb of a novel autoregulatory feedback loop (DEC loop) which differs from the one formed by the PER and CRY transcriptional repressors (PER/CRY loop). Both these loops are interlocked as it represses the expression of PER1/2 and in turn is repressed by PER1/2 and CRY1/2. Represses the activity of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1|ARNTL2/BMAL2 heterodimer by competing for the binding to E-box elements (5'-CACGTG-3') found within the promoters of its target genes. Negatively regulates its own expression and the expression of DBP and BHLHE41/DEC2. Acts as a corepressor of RXR and the RXR-LXR heterodimers and represses the ligand-induced RXRA and NR1H3/LXRA transactivation activity. May be involved in the regulation of chondrocyte differentiation via the cAMP pathway. [UniProt] |
| Cellular Localization | Cytoplasm. Nucleus. Note=Predominantly localized in the nucleus (PubMed:11278694). [UniProt] |
| Calculated MW | 46 kDa |
| PTM | Ubiquitinated; which may lead to proteasomal degradation. Sumoylation inhibits its ubiquitination and promotes its negative regulation of the CLOCK-ARNTL/BMAL1 heterodimer transcriptional activator activity. [UniProt] |
Images (2) Click the Picture to Zoom In
-
ARG41307 anti-BHLHB2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human alveolar tissue (epithelial cells of renal tubule) stained with ARG41307 anti-BHLHB2 antibody at 4 - 8 µg/ml dilution.
-
ARG41307 anti-BHLHB2 antibody WB image
Western blot: Human fetal lung lysate stained with ARG41307 anti-BHLHB2 antibody at 1 µg/ml dilution.
