ARG43213
anti-Aquaporin 7 antibody
anti-Aquaporin 7 antibody for Western blot and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes Aquaporin 7 |
---|---|
Tested Reactivity | Hu |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | Aquaporin 7 |
Antigen Species | Human |
Immunogen | Synthetic peptide around the C-terminal region of Human Aquaporin 7. (within the following region: DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA) |
Conjugation | Un-conjugated |
Alternate Names | Aquaporin-7; AQP7L; AQPap; AQP-7; GLYCQTL; Aquaporin-7-like; AQP9; Aquaporin adipose; Aquaglyceroporin-7 |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
Positive Control | Human heart | ||||
Observed Size | ~ 32 kDa |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | AQP7 |
Gene Full Name | aquaporin 7 |
Background | This gene encodes a member of the aquaporin family of water-selective membrane channels. The encoded protein localizes to the plasma membrane and allows movement of water, glycerol and urea across cell membranes. This gene is highly expressed in the adipose tissue where the encoded protein facilitates efflux of glycerol. In the proximal straight tubules of kidney, the encoded protein is localized to the apical membrane and prevents excretion of glycerol into urine. The encoded protein is present in spermatids, as well as in the testicular and epididymal spermatozoa suggesting an important role in late spermatogenesis. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. This gene is located adjacent to a related aquaporin gene on chromosome 9. Multiple pseudogenes of this gene have been identified. [provided by RefSeq, Dec 2015] |
Function | Forms a channel that mediates water and glycerol transport across cell membranes at neutral pH (PubMed:9405233, PubMed:11952783, PubMed:30423801, PubMed:30420639). The channel is also permeable to urea (PubMed:9405233). Plays an important role in body energy homeostasis under conditions that promote lipid catabolism, giving rise to glycerol and free fatty acids. Mediates glycerol export from adipocytes. After release into the blood stream, glycerol is used for gluconeogenesis in the liver to maintain normal blood glucose levels and prevent fasting hypoglycemia. Required for normal glycerol reabsorption in the kidney (By similarity). [UniProt] |
Cellular Localization | Membrane; Multi-pass membrane protein. [UniProt] |
Calculated MW | 37 kDa |
Images (1) Click the Picture to Zoom In