ARG59661
anti-Annexin A8 antibody
anti-Annexin A8 antibody for Flow cytometry,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Annexin A8 |
|---|---|
| Tested Reactivity | Hu |
| Tested Application | FACS, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Annexin A8 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 20-61 of Human Annexin A8. (HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK) |
| Conjugation | Un-conjugated |
| Alternate Names | ANX8; VAC-beta; CH17-360D5.2; Annexin VIII; Vascular anticoagulant-beta; Annexin A8; Annexin-8 |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | ANXA8 |
| Gene Full Name | annexin A8 |
| Background | This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10. [provided by RefSeq, Jul 2008] |
| Function | This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. [UniProt] |
| Calculated MW | 37 kDa |
Images (2) Click the Picture to Zoom In
-
ARG59661 anti-Annexin A8 antibody WB image
Western blot: 50 µg of samples under reducing conditions. HeLa and A549 whole cell lysates stained with ARG59661 anti-Annexin A8 antibody at 0.5 µg/ml, overnight at 4°C.
-
ARG59661 anti-Annexin A8 antibody FACS image
Flow Cytometry: U2OS cells were blocked with 10% normal goat serum and then stained with ARG59661 anti-Annexin A8 antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
