ARG58211
anti-Annexin A4 antibody
anti-Annexin A4 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Annexin A4 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Annexin A4 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence in the middle region of Human Annexin IV (119-152aa EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL), different from the related Mouse and Rat sequences by three amino acids. |
| Conjugation | Un-conjugated |
| Alternate Names | PAP-II; 35-beta calcimedin; Protein II; Annexin IV; ANX4; PP4-X; P32.5; Annexin A4; Annexin-4; Carbohydrate-binding protein p33/p41; Lipocortin IV; HEL-S-274; Endonexin I; Placental anticoagulant protein II; PIG28; Chromobindin-4; ZAP36 |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | ANXA4 |
| Gene Full Name | annexin A4 |
| Background | Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. [provided by RefSeq, Jul 2008] |
| Function | Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. [UniProt] |
| Calculated MW | 36 kDa |
Images (6) Click the Picture to Zoom In
-
ARG58211 anti-Annexin A4 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse thymus tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG58211 anti-Annexin A4 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG58211 anti-Annexin A4 antibody WB image
Western blot: 50 µg of Rat liver, Rat kidney, Mouse liver and Mouse kidney lysates stained with ARG58211 anti-Annexin A4 antibody at 0.5 µg/ml, overnight at 4°C, under reducing conditions.
-
ARG58211 anti-Annexin A4 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat thymus tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG58211 anti-Annexin A4 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG58211 anti-Annexin A4 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat pancreas tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG58211 anti-Annexin A4 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG58211 anti-Annexin A4 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human intestinal cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG58211 anti-Annexin A4 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG58211 anti-Annexin A4 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human mammary cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG58211 anti-Annexin A4 antibody at 1 µg/ml dilution, overnight at 4°C.
