ARG58372
anti-ATP2A3 / SERCA3 ATPase antibody
anti-ATP2A3 / SERCA3 ATPase antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes ATP2A3 / SERCA3 ATPase |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Cow, Rat, Dog, Gpig, Hrs, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | ATP2A3 / SERCA3 ATPase |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human ATP2A3 / SERCA3 ATPase. (within the following sequence: LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS) |
| Conjugation | Un-conjugated |
| Alternate Names | SERCA3; SR Ca; Sarcoplasmic/endoplasmic reticulum calcium ATPase 3; EC 3.6.3.8; Calcium pump 3; 2+ |
Application Instructions
| Predict Reactivity Note | Predicted homology based on immunogen sequence: Cow: 79%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Rabbit: 77%; Rat: 79% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Jurkat |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q93084 Human Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 |
|---|---|
| Gene Symbol | ATP2A3 |
| Gene Full Name | ATPase, Ca++ transporting, ubiquitous |
| Background | This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
| Function | This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. [UniProt] |
| Calculated MW | 114 kDa |
Images (2) Click the Picture to Zoom In
-
ARG58372 anti-ATP2A3 / SERCA3 ATPase antibody WB image
Western blot: Jurkat cell lysate stained with ARG58372 anti-ATP2A3 / SERCA3 ATPase antibody at 0.2 - 1 µg/ml dilution.
-
ARG58372 anti-ATP2A3 / SERCA3 ATPase antibody WB image
Western blot: MCF7 cell lysate stained with ARG58372 anti-ATP2A3 / SERCA3 ATPase antibody at 1 µg/ml dilution.
