ARG59758
anti-AP3D1 antibody
anti-AP3D1 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes AP3D1 |
|---|---|
| Tested Reactivity | Hu |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | AP3D1 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human AP3D1. (within the following region: RHSSLPTESDEDIAPAQQVDIVTEEMPENALPSDEDDKDPNDPYRALDID) |
| Conjugation | Un-conjugated |
| Alternate Names | ADTD; hBLVR; AP-3 complex subunit delta; Adaptor-related protein complex 3 subunit delta-1; AP-3 complex subunit delta-1; Delta-adaptin |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Observed Size | ~ 130 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | AP3D1 |
| Gene Full Name | adaptor-related protein complex 3, delta 1 subunit |
| Background | The protein encoded by this gene is a subunit of the AP3 adaptor-like complex, which is not clathrin-associated, but is associated with the golgi region, as well as more peripheral structures. The AP-3 complex facilitates the budding of vesicles from the golgi membrane, and may be directly involved in trafficking to lysosomes. This subunit is implicated in intracellular biogenesis and trafficking of pigment granules, and possibly platelet dense granules and neurotransmitter vesicles. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011] |
| Function | Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. [UniProt] |
| Cellular Localization | Cytoplasm. Golgi apparatus membrane; Peripheral membrane protein; Cytoplasmic side. [UniProt] |
| Calculated MW | 130 kDa |
Images (1) Click the Picture to Zoom In
-
ARG59758 anti-AP3D1 antibody WB image
Western blot: HeLa whole cell lysate stained with ARG59758 anti-AP3D1 antibody at 1 µg/ml dilution.
