ARG59313
anti-ANGPTL2 antibody
anti-ANGPTL2 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
Product Description | Rabbit Polyclonal antibody recognizes ANGPTL2 |
---|---|
Tested Reactivity | Hu, Ms, Rat |
Tested Application | IHC-P, WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | ANGPTL2 |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to aa. 275-312 of Human ANGPTL2. (WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD) |
Conjugation | Un-conjugated |
Alternate Names | Angiopoietin-related protein 2; Angiopoietin-like protein 2; HARP; ARP2 |
Application Instructions
Application Suggestion |
|
||||||
---|---|---|---|---|---|---|---|
Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
Preservative | 0.05% Sodium azide |
Stabilizer | 5% BSA |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | ANGPTL2 |
Gene Full Name | angiopoietin-like 2 |
Background | Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action. [provided by RefSeq, Jul 2008] |
Function | Induces sprouting in endothelial cells through an autocrine and paracrine action. [UniProt] |
Cellular Localization | Secreted. [UniProt] |
Calculated MW | 57 kDa |
PTM | N-glycosylated. [UniProt] |
Images (5) Click the Picture to Zoom In
-
ARG59313 anti-ANGPTL2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse intestine stained with ARG59313 anti-ANGPTL2 antibody at 1 µg/ml dilution.
-
ARG59313 anti-ANGPTL2 antibody WB image
Western blot: Rat stomach and Mouse ovary lysates stained with ARG59313 anti-ANGPTL2 antibody at 0.5 µg/ml dilution.
-
ARG59313 anti-ANGPTL2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat intestine stained with ARG59313 anti-ANGPTL2 antibody at 1 µg/ml dilution.
-
ARG59313 anti-ANGPTL2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat cardiac muscle stained with ARG59313 anti-ANGPTL2 antibody at 1 µg/ml dilution.
-
ARG59313 anti-ANGPTL2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human intetsinal cancer stained with ARG59313 anti-ANGPTL2 antibody at 1 µg/ml dilution.