ARG22461
anti-AMH antibody [5/6]
anti-AMH antibody [5/6] for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Baboon,Monkey,Sheep
Overview
| Product Description | Mouse Monoclonal antibody [5/6] recognizes AMH This antibody recognizes human anti-mullerian hormone (AMH), originally classified as a foetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140 kDa disulphide linked precursor that is cleaved to release the mature 30 kDa homodimer. |
|---|---|
| Tested Reactivity | Hu, Ms, Bb, Mk, Sheep |
| Tested Application | IHC-P, WB |
| Host | Mouse |
| Clonality | Monoclonal |
| Clone | 5/6 |
| Isotype | IgG1 |
| Target Name | AMH |
| Antigen Species | Human |
| Immunogen | Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC) |
| Conjugation | Un-conjugated |
| Alternate Names | AMH; Muellerian-inhibiting substance; MIF; Anti-Muellerian hormone; Muellerian-inhibiting factor; MIS |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: This product requires antigen retrieval using heat treatment prior to staining of paraffin sections.Sodium citrate buffer pH 6.0 is recommended for this purpose. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Tissue Culture Supernatant |
| Buffer | Tissue Culture Supernatant and 0.1% Sodium azide. |
| Preservative | 0.1% Sodium azide |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | AMH |
| Gene Full Name | anti-Mullerian hormone |
| Background | Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome. [provided by RefSeq, Jul 2008] |
| Function | This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin. [UniProt] |
| Calculated MW | 59 kDa |
Images (1) Click the Picture to Zoom In
-
ARG22461 anti-AMH antibody [5/6] IHC-P image
Immunohistochemistry: Formalin-fixed and paraffin-embedded ovarian tissue section from a 25 day old Mouse stained with ARG22461 anti-AMH antibody [5/6].
