ARG41262
anti-AKAP5 antibody
anti-AKAP5 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes AKAP5 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Hrs, Pig, Yeast |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | AKAP5 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human AKAP5. (within the following region: KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE) |
| Conjugation | Un-conjugated |
| Alternate Names | AKAP75; cAMP-dependent protein kinase regulatory subunit II high affinity-binding protein; AKAP-5; H21; AKAP79; AKAP 79; A-kinase anchor protein 79 kDa; A-kinase anchor protein 5 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 86%; Dog: 86%; Horse: 86%; Mouse: 79%; Pig: 86%; Rat: 79%; Yeast: 82% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Human muscle | ||||
| Observed Size | 47 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | AKAP5 |
| Gene Full Name | A kinase (PRKA) anchor protein 5 |
| Background | The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein binds to the RII-beta regulatory subunit of PKA, and also to protein kinase C and the phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchor the PKA protein at postsynaptic densities (PSD) and be involved in the regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT. [provided by RefSeq, Jul 2008] |
| Function | May anchor the PKA protein to cytoskeletal and/or organelle-associated proteins, targeting the signal carried by cAMP to specific intracellular effectors. Association with to the beta2-adrenergic receptor (beta2-AR) not only regulates beta2-AR signaling pathway, but also the activation by PKA by switching off the beta2-AR signaling cascade. [UniProt] |
| Cellular Localization | Membrane; Lipid-anchor. Note=Associates with lipid rafts. [UniProt] |
| Calculated MW | 47 kDa |
| PTM | Palmitoylation at Cys-36 and Cys-129 plays a key role in targeting to lipid rafts. [UniProt] |
Images (1) Click the Picture to Zoom In
-
ARG41262 anti-AKAP5 antibody WB image
Western blot: Human muscle lysate stained with ARG41262 anti-AKAP5 antibody at 0.2 - 1 µg/ml dilution.
