ARG59317
anti-AKAP2 antibody
anti-AKAP2 antibody for Western blot and Human,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes AKAP2 |
|---|---|
| Tested Reactivity | Hu, Rat |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | AKAP2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 813-852 of Human AKAP2. (ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN) |
| Conjugation | Un-conjugated |
| Alternate Names | AKAP-2; AKAPKL; PRKA2; A-kinase anchor protein 2; AKAP-KL; Protein kinase A-anchoring protein 2 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | AKAP2 |
| Gene Full Name | A kinase (PRKA) anchor protein 2 |
| Background | The protein encoded by this gene binds to the regulatory subunit of protein kinase A and is found associated with the actin cytoskeleton. The encoded protein mediates signals carried by cAMP and may be involved in creating polarity in certain signaling processes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011] |
| Function | Binds to regulatory subunit (RII) of protein kinase A. May be involved in establishing polarity in signaling systems or in integrating PKA-RII isoforms with downstream effectors to capture, amplify and focus diffuse, trans-cellular signals carried by cAMP (By similarity). [UniProt] |
| Calculated MW | 95 kDa |
Images (1) Click the Picture to Zoom In
-
ARG59317 anti-AKAP2 antibody WB image
Western blot: Rat cardiac muscle and HepG2 whole cell lysates stained with ARG59317 anti-AKAP2 antibody at 0.5 µg/ml dilution.
