ARG43064
anti-SORBS3 / Vinexin antibody
anti-SORBS3 / Vinexin antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes SORBS3 / Vinexin |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | FACS, ICC/IF, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | SORBS3 / Vinexin |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human SORBS3 / Vinexin. (ASTKIPASQHTQNWSATWTKDSKRRDKRWVKYE) |
| Conjugation | Un-conjugated |
| Alternate Names | SH3-containing adapter molecule 1; Sorbin and SH3 domain-containing protein 3; SCAM-1; Vinexin; SCAM1; SH3D4 |
Application Instructions
| Application Suggestion |
|
||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | SORBS3 |
| Gene Full Name | sorbin and SH3 domain containing 3 |
| Background | This gene encodes an SH3 domain-containing adaptor protein. The presence of SH3 domains play a role in this protein's ability to bind other cytoplasmic molecules and contribute to cystoskeletal organization, cell adhesion and migration, signaling, and gene expression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011] |
| Function | Vinexin alpha isoform promotes up-regulation of actin stress fiber formation. Vinexin beta isoform plays a role in cell spreading and enhances the activation of JNK/SAPK in response to EGF stimulation by using its third SH3 domain. [UniProt] |
| Cellular Localization | Isoform Alpha: Cell junction. Cytoplasm, cytoskeleton. Note=Localized at cell-extracellular matrix junctions (By similarity). Both isoforms were localized at focal adhesion and cell-cell adhesion sites. Isoform Beta: Cell junction. Nucleus. Cytoplasm, cytoskeleton. Note=Localized at cell-extracellular matrix junctions (By similarity). Both isoforms were localized at focal adhesion and cell-cell adhesion sites, vinexin beta was also found in the nucleus. [UniProt] |
| Calculated MW | 75 kDa |
| PTM | Phosphorylated at Ser-530 by MAPK1/ERK2 during cell spreading. [UniProt] |
Images (8) Click the Picture to Zoom In
-
ARG43064 anti-SORBS3 / Vinexin antibody ICC/IF image
Immunofluorescence: A549 cells were blocked with 10% goat serum and then stained with ARG43064 anti-SORBS3 / Vinexin antibody (green) at 2 µg/ml dilution, overnight at 4°C. DAPI (blue) for nuclear staining.
-
ARG43064 anti-SORBS3 / Vinexin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human liver cancer tissue. Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43064 anti-SORBS3 / Vinexin antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG43064 anti-SORBS3 / Vinexin antibody WB image
Western blot: 50 µg of sample under reducing conditions. THP-1, Rat liver, Mouse brain and HEPA1-6 whole cell lysates stained with ARG43064 anti-SORBS3 / Vinexin antibody at 0.5 µg/ml dilution, overnight at 4°C.
-
ARG43064 anti-SORBS3 / Vinexin antibody FACS image
Flow Cytometry: A431 cells were blocked with 10% normal goat serum and then stained with ARG43064 anti-SORBS3 / Vinexin antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
-
ARG43064 anti-SORBS3 / Vinexin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse intestine tissue. Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43064 anti-SORBS3 / Vinexin antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG43064 anti-SORBS3 / Vinexin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse intestine tissue. Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43064 anti-SORBS3 / Vinexin antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG43064 anti-SORBS3 / Vinexin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat intestinal lymph node tissue. Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43064 anti-SORBS3 / Vinexin antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG43064 anti-SORBS3 / Vinexin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat intestine tissue. Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43064 anti-SORBS3 / Vinexin antibody at 1 µg/ml dilution, overnight at 4°C.
