ARG59019
anti-Periplakin antibody
anti-Periplakin antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Periplakin |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | FACS, ICC/IF, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Periplakin |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 1664-1701 of Human Periplakin (DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK). |
| Conjugation | Un-conjugated |
| Alternate Names | 190 kDa paraneoplastic pemphigus antigen; Periplakin; 195 kDa cornified envelope precursor protein |
Application Instructions
| Application Suggestion |
|
||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | PPL |
| Gene Full Name | periplakin |
| Background | The protein encoded by this gene is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling. [provided by RefSeq, Jul 2008] |
| Function | Component of the cornified envelope of keratinocytes. May link the cornified envelope to desmosomes and intermediate filaments. May act as a localization signal in PKB/AKT-mediated signaling. [UniProt] |
| Cellular Localization | Cell junction, desmosome. Cytoplasm, cytoskeleton. Cell membrane. Nucleus. Mitochondrion. Associated with desmosomes and intermediate filaments. [UniProt] |
| Calculated MW | 205 kDa |
Images (9) Click the Picture to Zoom In
-
ARG59019 anti-Periplakin antibody ICC/IF image
Immunofluorescence: SK-OV-3 cells were blocked with 10% goat serum and then stained with ARG59019 anti-Periplakin antibody (green) at 2 µg/ml dilution, overnight at 4°C. DAPI (blue) for nuclear staining.
-
ARG59019 anti-Periplakin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse lung tissue stained with ARG59019 anti-Periplakin antibody at 1 µg/ml dilution.
-
ARG59019 anti-Periplakin antibody WB image
Western blot: Rat stomach and HeLa lysates stained with ARG59019 anti-Periplakin antibody at 0.5 µg/ml dilution.
-
ARG59019 anti-Periplakin antibody FACS image
Flow Cytometry: U2OS cells were blocked with 10% normal goat serum and then stained with ARG59019 anti-Periplakin antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
-
ARG59019 anti-Periplakin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat lung tissue stained with ARG59019 anti-Periplakin antibody at 1 µg/ml dilution.
-
ARG59019 anti-Periplakin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat skin tissue stained with ARG59019 anti-Periplakin antibody at 1 µg/ml dilution.
-
ARG59019 anti-Periplakin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human tonsil tissue stained with ARG59019 anti-Periplakin antibody at 1 µg/ml dilution.
-
ARG59019 anti-Periplakin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human lung cancer tissue stained with ARG59019 anti-Periplakin antibody at 1 µg/ml dilution.
-
ARG59019 anti-Periplakin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human oesophagus squama cancer tissue stained with ARG59019 anti-Periplakin antibody at 1 µg/ml dilution.
