ARG40991

anti-Peptide YY antibody

anti-Peptide YY antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes Peptide YY
Tested Reactivity Ms, Rat
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name Peptide YY
Antigen Species Mouse
Immunogen Synthetic peptide corresponding to aa. 29-64 of Mouse Peptide YY (YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY).
Conjugation Un-conjugated
Alternate Names Peptide tyrosine tyrosine; PYY; PYY-I; PYY1; Peptide YY; PYY-II; 3-36

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P1:200 - 1:1000
WB1:500 - 1:2000
Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 217212 Mouse PYY

GeneID: 287730 Rat PYY

Swiss-port # P10631 Rat Peptide YY

Swiss-port # Q9EPS2 Mouse Peptide YY

Gene Symbol PYY
Gene Full Name peptide YY
Background The protein encoded by this gene is proteolytically processed to release a peptide that inhibits pancreatic secretion and mobility in the gut. Rare variations in this gene could increase susceptibility to obesity. [provided by RefSeq, Jul 2010]
Function This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility. [UniProt]
Cellular Localization Secreted. [UniProt]
Calculated MW 11 kDa
PTM The peptide YY form is cleaved at Pro-30 by the prolyl endopeptidase FAP (seprase) activity (in vitro) to generate peptide YY(3-36). [UniProt]

Images (6) Click the Picture to Zoom In

  • ARG40991 anti-Peptide YY antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Mouse intestine tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40991 anti-Peptide YY antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG40991 anti-Peptide YY antibody WB image

    Western blot: 50 µg of samples under reducing conditions. Mouse spleen and Mouse liver lysates stained with ARG40991 anti-Peptide YY antibody at 0.5 µg/ml, overnight at 4°C.

  • ARG40991 anti-Peptide YY antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Mouse intestine tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40991 anti-Peptide YY antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG40991 anti-Peptide YY antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Mouse pancreas tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40991 anti-Peptide YY antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG40991 anti-Peptide YY antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Rat intestine tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40991 anti-Peptide YY antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG40991 anti-Peptide YY antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Rat pancreas tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40991 anti-Peptide YY antibody at 1 µg/ml dilution, overnight at 4°C.