ARG57559

anti-Neuropeptide Y antibody

anti-Neuropeptide Y antibody for IHC-Formalin-fixed paraffin-embedded sections and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes Neuropeptide Y
Tested Reactivity Hu, Ms, Rat
Tested Application IHC-P
Specificity The sequence of immunogen for this Neuropeptide Y antibody is 100% homologous in Human, Mouse and Rat.
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name Neuropeptide Y
Antigen Species Human
Immunogen Synthetic peptide around the center region of Human Neuropeptide Y. (YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY)
Conjugation Un-conjugated
Alternate Names Pro-neuropeptide Y; Neuropeptide tyrosine; NPY; CPON; PYY4

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P0.5 - 1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer PBS, 0.025% Sodium azide and 2.5% BSA.
Preservative 0.025% Sodium azide
Stabilizer 2.5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 109648 Mouse NPY

GeneID: 24604 Rat NPY

GeneID: 4852 Human NPY

Gene Symbol NPY
Gene Full Name neuropeptide Y
Background This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi. [provided by RefSeq, Oct 2014]
Function NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. [UniProt]
Highlight Related news:
Studying obesity and appetite control by quantifying orexigenic and anorexigenic hormones;
Calculated MW 11 kDa
PTM The neuropeptide Y form is cleaved at Pro-30 by the prolyl endopeptidase FAP (seprase) activity (in vitro). [UniProt]

Images (2) Click the Picture to Zoom In

  • ARG57559 anti-Neuropeptide Y antibody IHC-P image

    Immunohistochemistry: Formalin-fixed and paraffin-embedded Mouse brain tissue stained with ARG57559 anti-Neuropeptide Y antibody.

  • ARG57559 anti-Neuropeptide Y antibody IHC-P image

    Immunohistochemistry: Formalin-fixed and paraffin-embedded Rat brain tissue stained with ARG57559 anti-Neuropeptide Y antibody.