ARG57559
anti-Neuropeptide Y antibody
anti-Neuropeptide Y antibody for IHC-Formalin-fixed paraffin-embedded sections and Human,Mouse,Rat
Overview
Product Description | Rabbit Polyclonal antibody recognizes Neuropeptide Y |
---|---|
Tested Reactivity | Hu, Ms, Rat |
Tested Application | IHC-P |
Specificity | The sequence of immunogen for this Neuropeptide Y antibody is 100% homologous in Human, Mouse and Rat. |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | Neuropeptide Y |
Antigen Species | Human |
Immunogen | Synthetic peptide around the center region of Human Neuropeptide Y. (YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY) |
Conjugation | Un-conjugated |
Alternate Names | Pro-neuropeptide Y; Neuropeptide tyrosine; NPY; CPON; PYY4 |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | PBS, 0.025% Sodium azide and 2.5% BSA. |
Preservative | 0.025% Sodium azide |
Stabilizer | 2.5% BSA |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | NPY |
Gene Full Name | neuropeptide Y |
Background | This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi. [provided by RefSeq, Oct 2014] |
Function | NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. [UniProt] |
Highlight | Related news: Studying obesity and appetite control by quantifying orexigenic and anorexigenic hormones; |
Calculated MW | 11 kDa |
PTM | The neuropeptide Y form is cleaved at Pro-30 by the prolyl endopeptidase FAP (seprase) activity (in vitro). [UniProt] |
Images (2) Click the Picture to Zoom In
-
ARG57559 anti-Neuropeptide Y antibody IHC-P image
Immunohistochemistry: Formalin-fixed and paraffin-embedded Mouse brain tissue stained with ARG57559 anti-Neuropeptide Y antibody.
-
ARG57559 anti-Neuropeptide Y antibody IHC-P image
Immunohistochemistry: Formalin-fixed and paraffin-embedded Rat brain tissue stained with ARG57559 anti-Neuropeptide Y antibody.