ARG59272

anti-KDM5B / Jarid1B antibody

anti-KDM5B / Jarid1B antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat,Monkey

Overview

Product Description Rabbit Polyclonal antibody recognizes KDM5B / Jarid1B
Tested Reactivity Hu, Ms, Rat, Mk
Predict Reactivity Bov, Dog, Hm, Hrs, Rb
Tested Application FACS, ICC/IF, IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name KDM5B / Jarid1B
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 641-685 of Human KDM5B / Jarid1B. (DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELL)
Conjugation Un-conjugated
Alternate Names PPP1R98; Histone demethylase JARID1B; PUT1; RBBP2H1A; Cancer/testis antigen 31; Jumonji/ARID domain-containing protein 1B; Retinoblastoma-binding protein 2 homolog 1; PLU-1; PLU1; RBP2-H1; CT31; EC 1.14.11.-; Lysine-specific demethylase 5B; JARID1B

Application Instructions

Application Suggestion
Tested Application Dilution
FACS1:150 - 1:500
ICC/IF1:200 - 1:1000
IHC-P1:200 - 1:1000
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0).
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4 and 4% Trehalose.
Stabilizer 4% Trehalose
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 10765 Human KDM5B

GeneID: 75605 Mouse KDM5B

Swiss-port # Q80Y84 Mouse Lysine-specific demethylase 5B

Swiss-port # Q9UGL1 Human Lysine-specific demethylase 5B

Gene Symbol KDM5B
Gene Full Name lysine (K)-specific demethylase 5B
Background This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing resultsi n multiple transcript variants. [provided by RefSeq, Sep 2015]
Function Histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. Demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. Acts as a transcriptional corepressor for FOXG1B and PAX9. Favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5. In contrast, may act as a tumor suppressor for melanoma. Represses the CLOCK-ARNTL/BMAL1 heterodimer-mediated transcriptional activation of the core clock component PER2 (By similarity). [UniProt]
Cellular Localization Nucleus. [UniProt]
Highlight Related products:
KDM5B antibodies; Anti-Rabbit IgG secondary antibodies;
Related news:
Hypoxia-induced transcription, histone demethylases are involved
Calculated MW 176 kDa

Images (10) Click the Picture to Zoom In

  • ARG59272 anti-KDM5B / Jarid1B antibody ICC/IF image

    Immunofluorescence: MCF-7 cells were blocked with 10% goat serum and then stained with ARG59272 anti-KDM5B / Jarid1B antibody (green) at 2 µg/ml dilution, overnight at 4°C. DAPI (blue) for nuclear staining.

  • ARG59272 anti-KDM5B / Jarid1B antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human intestinal cancer tissue. Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59272 anti-KDM5B / Jarid1B antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG59272 anti-KDM5B / Jarid1B antibody WB image

    Western blot: Rat testis, Mouse testis and HepG2 whole cell lysates stained with ARG59272 anti-KDM5B / Jarid1B antibody at 0.5 µg/ml dilution.

  • ARG59272 anti-KDM5B / Jarid1B antibody WB image

    Western blot: 50 µg of sample under reducing conditions. COS-7, SH-SY5Y, Rat testis and Mouse testis lysates stained with ARG59272 anti-KDM5B / Jarid1B antibody at 0.5 µg/ml dilution, overnight at 4°C.

  • ARG59272 anti-KDM5B / Jarid1B antibody FACS image

    Flow Cytometry: U2OS cells were blocked with 10% normal goat serum and then stained with ARG59272 anti-KDM5B / Jarid1B antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.

  • ARG59272 anti-KDM5B / Jarid1B antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human intestinal cancer tissue. Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59272 anti-KDM5B / Jarid1B antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG59272 anti-KDM5B / Jarid1B antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human lung cancer tissue. Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59272 anti-KDM5B / Jarid1B antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG59272 anti-KDM5B / Jarid1B antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human breast cancer tissue. Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59272 anti-KDM5B / Jarid1B antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG59272 anti-KDM5B / Jarid1B antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Mouse testis tissue. Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59272 anti-KDM5B / Jarid1B antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG59272 anti-KDM5B / Jarid1B antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Rat testis tissue. Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59272 anti-KDM5B / Jarid1B antibody at 1 µg/ml dilution, overnight at 4°C.