ARG59272
anti-KDM5B / Jarid1B antibody
anti-KDM5B / Jarid1B antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat,Monkey
Overview
Product Description | Rabbit Polyclonal antibody recognizes KDM5B / Jarid1B |
---|---|
Tested Reactivity | Hu, Ms, Rat, Mk |
Predict Reactivity | Bov, Dog, Hm, Hrs, Rb |
Tested Application | FACS, ICC/IF, IHC-P, WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | KDM5B / Jarid1B |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to aa. 641-685 of Human KDM5B / Jarid1B. (DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELL) |
Conjugation | Un-conjugated |
Alternate Names | PPP1R98; Histone demethylase JARID1B; PUT1; RBBP2H1A; Cancer/testis antigen 31; Jumonji/ARID domain-containing protein 1B; Retinoblastoma-binding protein 2 homolog 1; PLU-1; PLU1; RBP2-H1; CT31; EC 1.14.11.-; Lysine-specific demethylase 5B; JARID1B |
Application Instructions
Application Suggestion |
|
||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
Preservative | 0.05% Sodium azide |
Stabilizer | 5% BSA |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | KDM5B |
Gene Full Name | lysine (K)-specific demethylase 5B |
Background | This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing resultsi n multiple transcript variants. [provided by RefSeq, Sep 2015] |
Function | Histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. Demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. Acts as a transcriptional corepressor for FOXG1B and PAX9. Favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5. In contrast, may act as a tumor suppressor for melanoma. Represses the CLOCK-ARNTL/BMAL1 heterodimer-mediated transcriptional activation of the core clock component PER2 (By similarity). [UniProt] |
Cellular Localization | Nucleus. [UniProt] |
Highlight | Related products: KDM5B antibodies; Anti-Rabbit IgG secondary antibodies; Related news: Hypoxia-induced transcription, histone demethylases are involved |
Calculated MW | 176 kDa |
Images (10) Click the Picture to Zoom In
-
ARG59272 anti-KDM5B / Jarid1B antibody ICC/IF image
Immunofluorescence: MCF-7 cells were blocked with 10% goat serum and then stained with ARG59272 anti-KDM5B / Jarid1B antibody (green) at 2 µg/ml dilution, overnight at 4°C. DAPI (blue) for nuclear staining.
-
ARG59272 anti-KDM5B / Jarid1B antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human intestinal cancer tissue. Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59272 anti-KDM5B / Jarid1B antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG59272 anti-KDM5B / Jarid1B antibody WB image
Western blot: Rat testis, Mouse testis and HepG2 whole cell lysates stained with ARG59272 anti-KDM5B / Jarid1B antibody at 0.5 µg/ml dilution.
-
ARG59272 anti-KDM5B / Jarid1B antibody WB image
Western blot: 50 µg of sample under reducing conditions. COS-7, SH-SY5Y, Rat testis and Mouse testis lysates stained with ARG59272 anti-KDM5B / Jarid1B antibody at 0.5 µg/ml dilution, overnight at 4°C.
-
ARG59272 anti-KDM5B / Jarid1B antibody FACS image
Flow Cytometry: U2OS cells were blocked with 10% normal goat serum and then stained with ARG59272 anti-KDM5B / Jarid1B antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
-
ARG59272 anti-KDM5B / Jarid1B antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human intestinal cancer tissue. Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59272 anti-KDM5B / Jarid1B antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG59272 anti-KDM5B / Jarid1B antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human lung cancer tissue. Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59272 anti-KDM5B / Jarid1B antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG59272 anti-KDM5B / Jarid1B antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human breast cancer tissue. Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59272 anti-KDM5B / Jarid1B antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG59272 anti-KDM5B / Jarid1B antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse testis tissue. Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59272 anti-KDM5B / Jarid1B antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG59272 anti-KDM5B / Jarid1B antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat testis tissue. Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59272 anti-KDM5B / Jarid1B antibody at 1 µg/ml dilution, overnight at 4°C.